PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf00245g04007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 488aa    MW: 54124 Da    PI: 6.282
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf00245g04007.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof116.88.8e-37142201261
                    zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                               ++k+l+cprC+st+tkfCyynn +++qPr+fC++C+ryWt+GG++rn+PvG+grrknk+ 
  Niben101Scf00245g04007.1 142 PDKILPCPRCNSTDTKFCYYNNNNVNQPRHFCRSCQRYWTAGGTMRNLPVGAGRRKNKNL 201
                               7899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-28139199IPR003851Zinc finger, Dof-type
PfamPF027016.4E-31144200IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.922146200IPR003851Zinc finger, Dof-type
PROSITE patternPS013610148184IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 488 aa     Download sequence    Send to blast
MTCDSEIKLF AKILPMVVSG EYSGAGRSTI DNRSSTGFDV DQYLEDNRTS SSENDEGSES  60
INYENQAADK DDIHITRELS EDKLEEEDQN QMMEISENPK TSSESEKSPK SPTNEDHQTV  120
RSSETENEPN TTDSQQTLLK KPDKILPCPR CNSTDTKFCY YNNNNVNQPR HFCRSCQRYW  180
TAGGTMRNLP VGAGRRKNKN LASHYHHISI PDDVLLASRI GSPNGFHHPM FKPNGTVLSF  240
GPKLPLYDSM VSALNPAERR APNVIPNGFY KQEHLNSSCK GGENGDDCSK GSSIKTSNMM  300
VEGGNIKPHE TVMRNTNGFP SPAPCLHGVP FPFPWNAAVP MSAIYPFGFP MPFYPAPYWS  360
SLPPWSNPWL SQPSRTENEK ASGSVPNSPL GKHSREGDDP EGNEPVEQKT SKRSILVPKT  420
LRIDDPDEAA KSSIWSTLGI KYDSASRGGF FKALQPKIDD KDHKDTTSPV LHANPAALSR  480
SLVLQERT
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009587069.10.0PREDICTED: cyclic dof factor 3-like
TrEMBLM1D6F90.0M1D6F9_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000830800.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA53224122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.12e-78cycling DOF factor 3